Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Galectin-9 (LGALS9)

This Recombinant Human Galectin-9 (LGALS9) spans the amino acid sequence from region 1-323aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Ecalectin; Tumor antigen HOM-HD-21

UniProt

O00182

Expression Region

1-323aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

42.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MAFSGSQAPYLSPAVPFSGTIQGGLQDGLQITVNGTVLSSSGTRFAVNFQTGFSGNDIAFHFNPRFEDGGYVVCNTRQNGSWGPEERKTHMPFQKGMPFDLCFLVQSSDFKVMVNGILFVQYFHRVPFHRVDTISVNGSVQLSYISFQPPGVWPANPAPITQTVIHTVQSAPGQMFSTPAIPPMMYPHPAYPMPFITTILGGLYPSKSILLSGTVLPSAQRFHINLCSGNHIAFHLNPRFDENAVVRNTQIDNSWGSEERSLPRKMPFVRGQSFSVWILCEAHCLKVAVDGQHLFEYYHRLRNLPTINRLEVGGDIQLTHVQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

LI Cadherin/Cadherin-17 Rabbit pAb
E45R26632N-50 50 µL

LI Cadherin/Cadherin-17 Rabbit pAb

Sign In for Pricing
View Details
ZNF385A, NT (ZNF385A, HZF, RZF, ZNF385, Zinc finger protein 385A, Hematopoietic zinc finger protein, Retinal zinc finger protein) (MaxLight 750) discontinued
044214-ML750 100 µL

ZNF385A, NT (ZNF385A, HZF, RZF, ZNF385, Zinc finger protein 385A, Hematopoietic zinc finger protein, Retinal zinc finger protein) (MaxLight 750) discontinued

Sign In for Pricing
View Details
T106C Polyclonal Antibody
MBS8531049-01 0.1 mg

T106C Polyclonal Antibody

Sign In for Pricing
View Details
T106C Polyclonal Antibody
MBS8531049-02 0.1 mL (AF635)

T106C Polyclonal Antibody

Sign In for Pricing
View Details
T106C Polyclonal Antibody
MBS8531049-03 0.1 mL (AF610)

T106C Polyclonal Antibody

Sign In for Pricing
View Details
T106C Polyclonal Antibody
MBS8531049-04 0.1 mL (AF405S)

T106C Polyclonal Antibody

Sign In for Pricing
View Details