Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Galectin-9 (Lgals9), partial

This Recombinant Mouse Galectin-9 (Lgals9), partial spans the amino acid sequence from region 195-322aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Lgals9

UniProt

O08573

Expression Region

195-322aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YTPIPNGLYPSKSIMISGNVLPDATRFHINLRCGGDIAFHLNPRFNENAVVRNTQINNSWGQEERSLLGRMPFSRGQSFSVWIICEGHCFKVAVNGQHMCEYYHRLKNLQDINTLEVAGDIQLTHVQT

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Fmoc-L-4-Pyridylalanine
MBS9023806-01 1 g

Fmoc-L-4-Pyridylalanine

Sign In for Pricing
View Details
Fmoc-L-4-Pyridylalanine
MBS9023806-02 5x 1 g

Fmoc-L-4-Pyridylalanine

Sign In for Pricing
View Details
Sorcin (SRI, 22kD Protein, CP-22, V19) (Azide Free) (FITC)
S5363-01-FITC 100 µL

Sorcin (SRI, 22kD Protein, CP-22, V19) (Azide Free) (FITC)

Sign In for Pricing
View Details
Lcn5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)
LV678628 1.0 µg DNA

Lcn5 Lentiviral Vector (Rat) (CMV) (pLenti-GIII-CMV-RFP-2A-Puro)

Sign In for Pricing
View Details
EDEM2 Knockout NCI-H1299 Polyclonal Cells
ARG40456 1 Million

EDEM2 Knockout NCI-H1299 Polyclonal Cells

Sign In for Pricing
View Details
Tripartite Motif-Containing Protein 54 (TRIM54) Antibody
abx145425-01 100 µg

Tripartite Motif-Containing Protein 54 (TRIM54) Antibody

Sign In for Pricing
View Details