Recombinant Horse Lutropin/choriogonadotropin subunit beta (LHB)
This Recombinant Horse Lutropin/choriogonadotropin subunit beta (LHB) spans the amino acid sequence from region 21-169aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
LSH-B/CG-B; Luteinizing hormone subunit beta; Lutropin/choriogonadotropin beta chain
UniProt
P08751
Expression Region
21-169aa
Tag
C-terminal 6xHis-tagged
Source
E.coli
Origin
Equus caballus (Horse)
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
22.6 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
SRGPLRPLCRPINATLAAEKEACPICITFTTSICAGYCPSMVRVMPAALPAIPQPVCTYRELRFASIRLPGCPPGVDPMVSFPVALSCHCGPCQIKTTDCGVFRDQPLACAPQASSSSKDPPSQPLTSTSTPTPGASRRSSHPLPIKTS
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
E-EL-H1360 96 Tests
ELISA kit for Human PPAR-? (Peroxisome Proliferator Activated Receptor Alpha)
Sign In for Pricing
View Details RC222828L4V 200 µL
SP140 (NM_007237) Human Tagged ORF Clone Lentiviral Particle
Sign In for Pricing
View Details