Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Diaphorina citri General odorant-binding protein 3 (LOC103507602)

This Recombinant Diaphorina citri General odorant-binding protein 3 (LOC103507602) spans the amino acid sequence from region 24-140aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A1S3CYV9

Expression Region

24-140aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Diaphorina citri (Asian citrus psyllid)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EIDESMKAVAKMIHDQCVDDSGVDPAVMDRIFSTKTMEPDEKFKCYLMCGLQQISAMDDDGNVDSEVFIGTMPEEFKSYAMEVVKKCSDVGGTSPCDKAYNMNVCAQKVDPNKYVFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit lymphocyte function associated antigen 3,LFA-3 ELISA Kit
CN-00648R1 96T

Rabbit lymphocyte function associated antigen 3,LFA-3 ELISA Kit

Sign In for Pricing
View Details
NSF Antibody - HRP Conjugated
OACA02082-100UG 100 µg

NSF Antibody - HRP Conjugated

Sign In for Pricing
View Details
Rimklb Adenovirus (Mouse)
39592054 1.0 mL

Rimklb Adenovirus (Mouse)

Sign In for Pricing
View Details
Lentiviral human SLC25A40 shRNA (UAS) - Lentiviral human SLC25A40 shRNA (UAS, RFP) (100)
GTR15135156 1 Vial

Lentiviral human SLC25A40 shRNA (UAS) - Lentiviral human SLC25A40 shRNA (UAS, RFP) (100)

Sign In for Pricing
View Details
Recombinant Vascular Endothelial Growth Factor C (VEGFC)
MBS2031451-01 0.01 mg

Recombinant Vascular Endothelial Growth Factor C (VEGFC)

Sign In for Pricing
View Details
Recombinant Vascular Endothelial Growth Factor C (VEGFC)
MBS2031451-02 0.05 mg

Recombinant Vascular Endothelial Growth Factor C (VEGFC)

Sign In for Pricing
View Details