Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Matrix metalloproteinase-14 (Mmp14), partial

This Recombinant Mouse Matrix metalloproteinase-14 (Mmp14), partial spans the amino acid sequence from region 112-541aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MMP-X1; MT-MMP; Membrane-type matrix metalloproteinase 1; Membrane-type-1 matrix metalloproteinase

UniProt

P53690

Expression Region

112-541aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

EDG-3 Polyclonal Antibody
JOT-AP02827-01 20 µL

EDG-3 Polyclonal Antibody

Sign In for Pricing
View Details
EDG-3 Polyclonal Antibody
JOT-AP02827-02 50 μL

EDG-3 Polyclonal Antibody

Sign In for Pricing
View Details
EDG-3 Polyclonal Antibody
JOT-AP02827-03 100 µL

EDG-3 Polyclonal Antibody

Sign In for Pricing
View Details
Mouse TR10B ELISA Kit
E106216 1 Each

Mouse TR10B ELISA Kit

Sign In for Pricing
View Details
ST-2560
orb3134677-01 50 mg

ST-2560

Sign In for Pricing
View Details
ST-2560
orb3134677-02 10 mg

ST-2560

Sign In for Pricing
View Details