Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Matrix metalloproteinase-14 (Mmp14), partial

This Recombinant Mouse Matrix metalloproteinase-14 (Mmp14), partial spans the amino acid sequence from region 112-541aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

MMP-X1; MT-MMP; Membrane-type matrix metalloproteinase 1; Membrane-type-1 matrix metalloproteinase

UniProt

P53690

Expression Region

112-541aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Musculoskeletal & Connective Tissue Research

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

56.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YAIQGLKWQHNEITFCIQNYTPKVGEYATFEAIRKAFRVWESATPLRFREVPYAYIREGHEKQADIMILFAEGFHGDSTPFDGEGGFLAHAYFPGPNIGGDTHFDSAEPWTVQNEDLNGNDIFLVAVHELGHALGLEHSNDPSAIMAPFYQWMDTENFVLPDDDRRGIQQLYGSKSGSPTKMPPQPRTTSRPSVPDKPKNPAYGPNICDGNFDTVAMLRGEMFVFKERWFWRVRNNQVMDGYPMPIGQFWRGLPASINTAYERKDGKFVFFKGDKHWVFDEASLEPGYPKHIKELGRGLPTDKIDAALFWMPNGKTYFFRGNKYYRFNEEFRAVDSEYPKNIKVWEGIPESPRGSFMGSDEVFTYFYKGNKYWKFNNQKLKVEPGYPKSALRDWMGCPSGGRPDEGTEEETEVIIIEVDEEGSGAVSAAA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SureCount Particle Count Standard ( 5um)
CC05N-10 10 mL

SureCount Particle Count Standard ( 5um)

Sign In for Pricing
View Details
Human KLF9 qPCR Primer Pair
QH11105S 200 Tests

Human KLF9 qPCR Primer Pair

Sign In for Pricing
View Details
Rabbit Polyclonal DEFA6 Antibody [DyLight 594]
NBP2-97543DL594 0.1 mL

Rabbit Polyclonal DEFA6 Antibody [DyLight 594]

Sign In for Pricing
View Details
Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) ZAPB Polyclonal Antibody
MBS7187767 Inquire

Rabbit anti-Escherichia coli O6:K15:H31 (strain 536/UPEC) ZAPB Polyclonal Antibody

Sign In for Pricing
View Details
Hepatitis B Virus Core antigen, Recombinant, Pichia (HBcAg)
MBS637263-01 1 mg

Hepatitis B Virus Core antigen, Recombinant, Pichia (HBcAg)

Sign In for Pricing
View Details
Hepatitis B Virus Core antigen, Recombinant, Pichia (HBcAg)
MBS637263-02 5x 1 mg

Hepatitis B Virus Core antigen, Recombinant, Pichia (HBcAg)

Sign In for Pricing
View Details