Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Matrix-remodeling-associated protein 5 (MXRA5), partial

This Recombinant Human Matrix-remodeling-associated protein 5 (MXRA5), partial spans the amino acid sequence from region 153-276aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Adhesion protein with leucine-rich repeats and immunoglobulin domains related to perlecan

UniProt

Q9NR99

Expression Region

153-276aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LRLLHLEGNLLHQLHPSTFSTFTFLDYFRLSTIRHLYLAENMVRTLPASMLRNMPLLENLYLQGNPWTCDCEMRWFLEWDAKSRGILKCKKDKAYEGGQLCAMCFSPKKLYKHEIHKLKDMTCL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Phospho-CREB-1 (Ser121) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated
bs-5270R-BF555 100 µL

Phospho-CREB-1 (Ser121) Polyclonal Antibody, AbBy Fluor™ 555 Conjugated

Sign In for Pricing
View Details
Anti-SLC22A18AS (4B1)
YF-MA20379 100 ug

Anti-SLC22A18AS (4B1)

Sign In for Pricing
View Details
LOC646066 siRNA (h)
sc-105870 10 µM

LOC646066 siRNA (h)

Sign In for Pricing
View Details
Anti-RBP4 Antibody-FITC (2J141)
TMAY-00680F-01 25 Tests

Anti-RBP4 Antibody-FITC (2J141)

Sign In for Pricing
View Details
Anti-RBP4 Antibody-FITC (2J141)
TMAY-00680F-02 100 Tests

Anti-RBP4 Antibody-FITC (2J141)

Sign In for Pricing
View Details
Transcription Factor EC (TFEC) Antibody
abx238628 100 µg

Transcription Factor EC (TFEC) Antibody

Sign In for Pricing
View Details