Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Taxus cuspidata Tubulin beta chain

This Recombinant Taxus cuspidata Tubulin beta chain spans the amino acid sequence from region 1-449aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

UniProt

A0A090AKL9

Expression Region

1-449aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Taxus cuspidata (Japanese yew)

Field of Research

Cell Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

57.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MREILHVQGGQCGNQIGSKFWEVVCEEHGIDHTGRYTGTSDLQLERVNVYYNEASCGRFVPRAVLMDLEPGTMDSVRTGPYGQVFRPDNFVFGQSGAGNNWAKGHYTEGAELIDAVLDVVRKEAENCDCLQGFQVCHSLGGGTGSGMGTLLISKIREEYPDRMMLTFSVFPSPKVSDTVVEPYNATLSVHQLVENADECMVLDNEALYDICFRTLKLTTPSFGDLNHLISATMSGVTCCLRFPGQLNSDLRKLAVNLIPFPRLHFFMVGFAPLTSRGSQNYRALTVPELTQQMWDAKNMMCAADPRHGRYLTASAMFRGKMSTKEVDEQMINVQNKNSSYFVEWIPNNVKSSVCDIPPWGMSMASTFIGNSTSIQEMFRRVSEQFTAMFRRKAFLHWYTGEGMDEMEFTEAESNMNDLVSEYQQYQDATADEEADFEDEESVVSGDVGM

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ProteoSpin Inclusion Body Protein Isolation Maxi Kit
17700 4 Preparations

ProteoSpin Inclusion Body Protein Isolation Maxi Kit

Sign In for Pricing
View Details
Polystyrene C4 OH
HB04508000.25G 25 g

Polystyrene C4 OH

Sign In for Pricing
View Details
Boc-Pyr-OH
TRC-B665195-2.5G 2.5 g

Boc-Pyr-OH

Sign In for Pricing
View Details
FITC Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091C-01 50 Tests

FITC Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details
FITC Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091C-02 100 Tests

FITC Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details
FITC Anti-Mouse CD106 Antibody[M/K-2.7]
E-AB-F1091C-03 2x 100 Tests

FITC Anti-Mouse CD106 Antibody[M/K-2.7]

Sign In for Pricing
View Details