Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicoverpa armigera OBP7

This Recombinant Helicoverpa armigera OBP7 spans the amino acid sequence from region 22-148aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

F5ANI5

Expression Region

22-148aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Helicoverpa armigera (Cotton bollworm) (Heliothis armigera)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSSEEELSIKEALHPFVVECAEEYGMTEEMFEEAKKKGSAEDIDPCFMSCFLKKTGFFDDSGKFDAEKSISFAKEHITSESAIKFLEAGAGECVKINDEDVSDGENGCDRAKLLFDCLTELKKKMSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

GPD2 Antibody
KC-32921-01 50 μL

GPD2 Antibody

Sign In for Pricing
View Details
GPD2 Antibody
KC-32921-02 100 µL

GPD2 Antibody

Sign In for Pricing
View Details
GPD2 Antibody
KC-32921-03 1 mL

GPD2 Antibody

Sign In for Pricing
View Details
BAZ2B Human Gene Knockout Kit (CRISPR)
KN421872 1 Kit

BAZ2B Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
NPAT Rabbit Polyclonal Antibody
TA362739 100 µL

NPAT Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CDC14B Rabbit Polyclonal Antibody
TA372202 100 µL

CDC14B Rabbit Polyclonal Antibody

Sign In for Pricing
View Details