Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Helicoverpa armigera OBP7

This Recombinant Helicoverpa armigera OBP7 spans the amino acid sequence from region 22-148aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

F5ANI5

Expression Region

22-148aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Helicoverpa armigera (Cotton bollworm) (Heliothis armigera)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

21.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSSEEELSIKEALHPFVVECAEEYGMTEEMFEEAKKKGSAEDIDPCFMSCFLKKTGFFDDSGKFDAEKSISFAKEHITSESAIKFLEAGAGECVKINDEDVSDGENGCDRAKLLFDCLTELKKKMSE

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

10X Buffer V3, 5 x 1ml
RB0210 5x 1 mL

10X Buffer V3, 5 x 1ml

Sign In for Pricing
View Details
GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D12]
TA810248AM 100 µL

GTP cyclohydrolase 1 (GCH1) Mouse Monoclonal Antibody (Biotin conjugated) [Clone ID: OTI2D12]

Sign In for Pricing
View Details
CD35 / CR1 (Follicular Dendritic Cell Marker) (To5), 1mg/mL
BNUM1318-50 1x 50 µL

CD35 / CR1 (Follicular Dendritic Cell Marker) (To5), 1mg/mL

Sign In for Pricing
View Details
Vimentin (VIM) Mouse Monoclonal Antibody [Clone ID: SPM576]
AM50186PU-T 20 µg

Vimentin (VIM) Mouse Monoclonal Antibody [Clone ID: SPM576]

Sign In for Pricing
View Details
Homer1 (BC064041) Mouse Tagged ORF Clone
MG201745 10 µg

Homer1 (BC064041) Mouse Tagged ORF Clone

Sign In for Pricing
View Details
Human sC5b-9 (Soluble Terminal Complement Complex C5b-9) ELISA Kit
E-EL-H2376-01 24 Tests

Human sC5b-9 (Soluble Terminal Complement Complex C5b-9) ELISA Kit

Sign In for Pricing
View Details