Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Osmia cornuta Odorant-binding protein 1

This Recombinant Osmia cornuta Odorant-binding protein 1 spans the amino acid sequence from region 20-143aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

M4VRP1

Expression Region

20-143aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Osmia cornuta

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LDQDAVIAKYMEYLMPNVKPCADEFHMTEDQAKNIQQAADGMDLKQLGCLKGCVMKRMGMLTGNNEFHLEPVYTMIESVHTGNDAEIQDVKKIAEECISSIQGEPDECNIGTKYSDCYIQKLFN

Available Sizes

More Discoveries

Explore Other Products

Browse additional items from our catalog

FGF14/FHF4 Antibody
E55A15055 100 µg

FGF14/FHF4 Antibody

Sign In for Pricing
View Details
Rabbit Polyclonal SLK Antibody
NBP3-04553-20ul 20 µL

Rabbit Polyclonal SLK Antibody

Sign In for Pricing
View Details
DCST1 CRISPR/Cas9 KO Plasmid (m)
sc-429580 20 µg

DCST1 CRISPR/Cas9 KO Plasmid (m)

Sign In for Pricing
View Details
Centanamycin
orb2566645-01 10 mg

Centanamycin

Sign In for Pricing
View Details
Centanamycin
orb2566645-02 50 mg

Centanamycin

Sign In for Pricing
View Details
Lentiviral human TP53INP2 shRNA (UAS) - Lentiviral human TP53INP2 shRNA (UAS, iRFP) plasmid
GTR15344191 1 Vial

Lentiviral human TP53INP2 shRNA (UAS) - Lentiviral human TP53INP2 shRNA (UAS, iRFP) plasmid

Sign In for Pricing
View Details