Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Sitophilus zeamais Odorant binding protein 1 (OBP1), partial

This Recombinant Sitophilus zeamais Odorant binding protein 1 (OBP1), partial spans the amino acid sequence from region 24-138aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OBP1

UniProt

A0A4P9CZ78

Expression Region

24-138aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Sitophilus zeamais (Maize weevil)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GTNDPQRQKIIDFHAECLDAHGLDEEAMIEALDGNPSEDDSFYHHLFCAAKKANVMTENGEVTLDTFHIDMAGVIDSHNMENIHNILRKCLVQKADIMTTLRDAVQCFIKEDHNL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ALCAM (CD166) Human
32-13025-5 5 µg

ALCAM (CD166) Human

Sign In for Pricing
View Details
General Gastrodin ELISA Kit (GTD)
RK00668 96 Tests

General Gastrodin ELISA Kit (GTD)

Sign In for Pricing
View Details
HERC5 Antibody Blocking Peptide
orb1511583 500 µg

HERC5 Antibody Blocking Peptide

Sign In for Pricing
View Details
RAP1GDS1 (F-1) Alexa Fluor® 680
sc-390003 AF680 200 µg/mL

RAP1GDS1 (F-1) Alexa Fluor® 680

Sign In for Pricing
View Details
Pcdh8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K4398407 1.0 µg DNA

Pcdh8 sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
B7H6/NCR3LG1 Rabbit Polyclonal Antibody (Fluoro594)
orb3097053 100 µg

B7H6/NCR3LG1 Rabbit Polyclonal Antibody (Fluoro594)

Sign In for Pricing
View Details