Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anopheles gambiae AGAP011647-PA (Obp1), partial

This Recombinant Anopheles gambiae AGAP011647-PA (Obp1), partial spans the amino acid sequence from region 43-289aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Obp1

UniProt

Q8WRX3

Expression Region

43-289aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Anopheles gambiae (African malaria mosquito)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

RDAGQLKRVVQAQEECVRYLRIPCARLAVYNKFIYPNDAETQCMVRCMGLNLGWWNDTHGVQEASMRSFFHPDPNDCDYERRTYRCLHSQRLDRPAPHDEACERAYESFRCYYEHYGNLVVTPQFVRLNALQQLDVLLQCADMLQYPMPDRSFSCAKTHVAGAEGDFDCVLRCYMLRTGLYSEQYGPNLDRIYVQCNNYANETVFRETTDACYQRLRSDCQDECTLIARYVRECFPAGGIIFLNSLW

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

NES sgRNA CRISPR Lentivector (Human) (Target 1)
K1417902 1.0 µg DNA

NES sgRNA CRISPR Lentivector (Human) (Target 1)

Sign In for Pricing
View Details
Recombinant Human Orofacial cleft 1 candidate gene 1 protein (OFCC1), partial
orb1652201-01 20 µg

Recombinant Human Orofacial cleft 1 candidate gene 1 protein (OFCC1), partial

Sign In for Pricing
View Details
Recombinant Human Orofacial cleft 1 candidate gene 1 protein (OFCC1), partial
orb1652201-02 100 µg

Recombinant Human Orofacial cleft 1 candidate gene 1 protein (OFCC1), partial

Sign In for Pricing
View Details
Recombinant Human Orofacial cleft 1 candidate gene 1 protein (OFCC1), partial
orb1652201-03 1 mg

Recombinant Human Orofacial cleft 1 candidate gene 1 protein (OFCC1), partial

Sign In for Pricing
View Details
NUMB, Control Peptide (Protein Numb Homolog, h-Numb, Protein S171)
147504 100 µg

NUMB, Control Peptide (Protein Numb Homolog, h-Numb, Protein S171)

Sign In for Pricing
View Details
YTHDF2 Rabbit Monoclonal Antibody
AMRe21415-01 50 µL

YTHDF2 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details