Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Anopheles gambiae AGAP010489-PA (OBP-4)

This Recombinant Anopheles gambiae AGAP010489-PA (OBP-4) spans the amino acid sequence from region 26-150aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OBP-4

UniProt

Q8T6R7

Expression Region

26-150aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Anopheles gambiae (African malaria mosquito)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.9 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AMTMKQLTNSMDMMRQACAPKFKVEEAELHGLRKSIFPANPDKELKCYAMCIAQMAGTMTKKGEISFSKTMAQIEAMLPPEMKTMAKEALTHCKDTQTSYKDPCDKAYFSAKCAADFTPDTFMFP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Olfr1032 (m) -PR
sc-150226-PR 10 µM - 20 µL

Olfr1032 (m) -PR

Sign In for Pricing
View Details
27-Hydroxymangiferonic acid
MBS5761414 Inquire

27-Hydroxymangiferonic acid

Sign In for Pricing
View Details
PE/Dazzle™ 594 anti-human CD137 (4-1BB)
GT08885 100 Tests

PE/Dazzle™ 594 anti-human CD137 (4-1BB)

Sign In for Pricing
View Details
Xcr1 3'UTR Luciferase Stable Cell Line
TU122362 1.0 mL

Xcr1 3'UTR Luciferase Stable Cell Line

Sign In for Pricing
View Details
SF3B3 Polyclonal Antibody
MBS8572773-01 0.1 mL

SF3B3 Polyclonal Antibody

Sign In for Pricing
View Details
SF3B3 Polyclonal Antibody
MBS8572773-02 0.1 mL (AF405L)

SF3B3 Polyclonal Antibody

Sign In for Pricing
View Details