Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Chlamydia trachomatis Major outer membrane porin, serovar H (ompA)

This Recombinant Chlamydia trachomatis Major outer membrane porin, serovar H (ompA) spans the amino acid sequence from region 23-397aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

OmpA

UniProt

P13467

Expression Region

23-397aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Chlamydia trachomatis

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

47.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPVGNPAEPSLMIDGILWEGFGGDPCDPCATWCDAISMRVGYYGDFVFDRVLKTDVNKEFQMGAAPTTNDAADLQNDPKTNVARPNPAYGKHMQDAEMFTNAAYMALNIWDRFDVFCTLGATTGYLKGNSASFNLVGLFGTKTKSSDFNTAKLVPNIALNRAVVELYTDTTFAWSVGARAALWECGCATLGASFQYAQSKPKVEELNVLCNASEFTINKPKGYVGAEFPLDITAGTEAATGTKDASIDYHEWQASLALSYRLNMFTPYIGVKWSRVSFDADTIRIAQPKLAEAILDVTTLNPTIAGKGTVVASGSDNDLADTMQIVSLQLNKMKSRKSCGIAVGTTIVDADKYAVTVETRLIDERAAHVNAQFRF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse 4933404K08Rik activation kit by CRISPRa
GA209698 1 Kit

Mouse 4933404K08Rik activation kit by CRISPRa

Sign In for Pricing
View Details
FAM49A Double Nickase Plasmid (m)
sc-429431-NIC 20 µg

FAM49A Double Nickase Plasmid (m)

Sign In for Pricing
View Details
TMEM25 siRNA (Human)
MBS8217992-01 15 nmol

TMEM25 siRNA (Human)

Sign In for Pricing
View Details
TMEM25 siRNA (Human)
MBS8217992-02 30 nmol

TMEM25 siRNA (Human)

Sign In for Pricing
View Details
TMEM25 siRNA (Human)
MBS8217992-03 5x 30 nmol

TMEM25 siRNA (Human)

Sign In for Pricing
View Details
PAK1 Adenovirus (Human)
35958051 250 µL

PAK1 Adenovirus (Human)

Sign In for Pricing
View Details