Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial

This Recombinant Rickettsia conorii Outer membrane protein B (ompB), partial spans the amino acid sequence from region 1363-1655aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

168 kDa surface-layer protein; Cell surface antigen 5; Surface protein antigen; rOmp B

UniProt

Q9KKA3

Expression Region

1363-1655aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Rickettsia conorii (strain ATCC VR-613 / Malish 7)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

GDEAVDNVAYGIWAKPFYTDAHQSKKGGLAGYKAKTTGVVIGLDTLANDNLMIGAAIGITKTDIKHQDYKKGDKTDVNGFSFSLYGAQQLVKNFFAQGSAIFSLNQVKNKSQRYFFDANGNMSKQIAAGHYDNMTFGGNLTVGYDYNAMQGVLVTPMAGLSYLKSSDENYKETGTTVANKQVNSKFSDRTDLIVGAKVAGSTMNITDLAVYPEVHAFVVHKVTGRLSKTQSVLDGQVTPCISQPDRTAKTSYNLGLSASIRSDAKMEYGIGYDAQISSKYTAHQGTLKVRVNF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CCDC53 Antibody, FITC conjugated
MBS1499379-01 0.05 mg

CCDC53 Antibody, FITC conjugated

Sign In for Pricing
View Details
CCDC53 Antibody, FITC conjugated
MBS1499379-02 0.1 mg

CCDC53 Antibody, FITC conjugated

Sign In for Pricing
View Details
CCDC53 Antibody, FITC conjugated
MBS1499379-03 5x 0.1 mg

CCDC53 Antibody, FITC conjugated

Sign In for Pricing
View Details
Recombinant Plasmodium fragile Apical membrane antigen 1 (AMA-1), partial
MBS1231539-01 0.5 mg (E-Coli)

Recombinant Plasmodium fragile Apical membrane antigen 1 (AMA-1), partial

Sign In for Pricing
View Details
Recombinant Plasmodium fragile Apical membrane antigen 1 (AMA-1), partial
MBS1231539-02 0.05 mg (Baculovirus)

Recombinant Plasmodium fragile Apical membrane antigen 1 (AMA-1), partial

Sign In for Pricing
View Details
Recombinant Plasmodium fragile Apical membrane antigen 1 (AMA-1), partial
MBS1231539-03 0.5 mg (Yeast)

Recombinant Plasmodium fragile Apical membrane antigen 1 (AMA-1), partial

Sign In for Pricing
View Details