Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Platelet factor 4 (PF4)

This Recombinant Human Platelet factor 4 (PF4) spans the amino acid sequence from region 32-101aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

C-X-C motif chemokine 4; Iroplact; Oncostatin-A

UniProt

P02776

Expression Region

32-101aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAEEDGDLQCLCVKTTSQVRPRHITSLEVIKAGPHCPTAQLIATLKNGRKICLDLQAPLYKKIIKKLLES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

STK11 Antibody
orb1282721 100 µL

STK11 Antibody

Sign In for Pricing
View Details
Anti-C17orf107 Antibody, Rabbit Polyclonal
MBS8110328-01 0.1 mL

Anti-C17orf107 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Anti-C17orf107 Antibody, Rabbit Polyclonal
MBS8110328-02 5x 0.1 mL

Anti-C17orf107 Antibody, Rabbit Polyclonal

Sign In for Pricing
View Details
Lentiviral mouse Cul4b shRNA (UAS) - Lentiviral mouse Cul4b shRNA (UAS, GFP) plasmid
GTR15115126 1 Vial

Lentiviral mouse Cul4b shRNA (UAS) - Lentiviral mouse Cul4b shRNA (UAS, GFP) plasmid

Sign In for Pricing
View Details
PRDM4 Rabbit Polyclonal Antibody (BF405)
orb2463597 100 µL

PRDM4 Rabbit Polyclonal Antibody (BF405)

Sign In for Pricing
View Details
HIF-1 Alpha Rabbit Polyclonal Antibody (PerCP-Cy7)
orb1586075 100 µL

HIF-1 Alpha Rabbit Polyclonal Antibody (PerCP-Cy7)

Sign In for Pricing
View Details