Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Transcription factor p65 (RELA), partial

This Recombinant Human Transcription factor p65 (RELA), partial spans the amino acid sequence from region 1-210aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Nuclear factor NF-kappa-B p65 subunit; Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3

UniProt

Q04206

Expression Region

1-210aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Cancer Biology

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDELFPLIFPAEPAQASGPYVEIIEQPKQRGMRFRYKCEGRSAGSIPGERSTDTTKTHPTIKINGYTGPGTVRISLVTKDPPHRPHPHELVGKDCRDGFYEAELCPDRCIHSFQNLGIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLCFQVTVRDPSGRPLRLPPVLSHPIFDNRAPNTAELKICRVNRNSGSCLGGD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Chromonar Hydrochloride
TRC-C432685-10MG 10 mg

Chromonar Hydrochloride

Sign In for Pricing
View Details
SH3BGRL3 (NM_031286) Human Recombinant Protein
TP304019L 1 mg

SH3BGRL3 (NM_031286) Human Recombinant Protein

Sign In for Pricing
View Details
N6-[(Allylamino]carbonothioyl]lysine-13C6,15N2
TRC-A614227-10MG 10 mg

N6-[(Allylamino]carbonothioyl]lysine-13C6,15N2

Sign In for Pricing
View Details
RIP3 (RIPK3) (C-term) Rabbit Polyclonal Antibody
AP14643PU-N 400 µL

RIP3 (RIPK3) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF568 conjugate, 0.1mg/mL
BNC681865-100 1x 100 µL

Napsin A (Lung Adenocarcinoma Marker) (NAPSA/1865R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Annexin VII (ANXA7) (NM_001156) Human Recombinant Protein
TP720184L 500 µg

Annexin VII (ANXA7) (NM_001156) Human Recombinant Protein

Sign In for Pricing
View Details