Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Resistin-like alpha (Retnla)

This Recombinant Mouse Resistin-like alpha (Retnla) spans the amino acid sequence from region 24-111aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cysteine-rich secreted protein A12-gamma; Cysteine-rich secreted protein FIZZ1; Hypoxia-induced mitogenic factor; Parasite-induced macrophage novel gene 1 protein; RELMalpha

UniProt

Q9EP95

Expression Region

24-111aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

16.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DETIEIIVENKVKELLANPANYPSTVTKTLSCTSVKTMNRWASCPAGMTATGCACGFACGSWEIQSGDTCNCLCLLVDWTTARCCQLS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

WRCH1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated
bs-1944R-BF594-TR 20 µL

WRCH1 Polyclonal Antibody, AbBy Fluor™ 594 Conjugated

Sign In for Pricing
View Details
F-box/SPRY domain-containing protein 1 (FBXO45) Mouse ELISA Kit
D3274 96 Tests

F-box/SPRY domain-containing protein 1 (FBXO45) Mouse ELISA Kit

Sign In for Pricing
View Details
Pyrophosphatase, Inorganic (E. coli)
K1087-50 50 Units

Pyrophosphatase, Inorganic (E. coli)

Sign In for Pricing
View Details
Rabbit Monoclonal TIM-1/KIM-1/HAVCR Antibody (002) [DyLight 680]
NBP2-90941FR 0.1 mL

Rabbit Monoclonal TIM-1/KIM-1/HAVCR Antibody (002) [DyLight 680]

Sign In for Pricing
View Details
CD207/Langerin Antibody
orb1537125 0.05 mL

CD207/Langerin Antibody

Sign In for Pricing
View Details
ZMYND11 discontinued
396303 200 µL

ZMYND11 discontinued

Sign In for Pricing
View Details