Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Rev (rev)
This Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Rev (rev) spans the amino acid sequence from region 1-116aa. Purity: Greater than 95% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
ART/TRS; Anti-repression transactivator; Regulator of expression of viral proteins
UniProt
P04618
Expression Region
1-116aa
Tag
C-terminal 6xHis-tagged
Source
E.coli
Origin
Human immunodeficiency virus type 1 group M subtype B (isolate HXB2) (HIV-1)
Field of Research
Infectious Disease & Virology; Epigenetics & Chromatin
Purity
Greater than 95% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
20.0 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MAGRSGDSDEELIRTVRLIKLLYQSNPPPNPEGTRQARRNRRRRWRERQRQIHSISERILGTYLGRSAEPVPLQLPPLERLTLDCNEDCGTSGTQGVGSPQILVESPTVLESGTKE
Available Sizes
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC471820-500 1x 500 µL
Ep-CAM / CD326 (Epithelial Marker) (rVU-1D9), CF647 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC680178-100 1x 100 µL
CD50 (ICAM-3) (186-2G9), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC050391-100 1x 100 µL
CD81 / TAPA-1 (1.3.3.22), CF405M conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC681953-500 1x 500 µL
CD21 (Mature B-Cell & Follicular Dendritic Cell Marker) (CR2/1953), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details