Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium-dependent phosphate transport protein 3 (SLC17A2), partial

This Recombinant Human Sodium-dependent phosphate transport protein 3 (SLC17A2), partial spans the amino acid sequence from region 1-97aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Na (+) /PI cotransporter 3; Sodium/phosphate cotransporter 3; Solute carrier family 17 member 2

UniProt

O00624

Expression Region

1-97aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

17.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MDGKPATRKGPDFCSLRYGLALIMHFSNFTMITQRVSLSIAIIAMVNTTQQQGLSNASTEGPVADAFNNSSISIKEFDTKASVYQWSPETQGIIFSS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

HCG-beta (Pregnancy & Choriocarcinoma Marker) ; Clone SPM105 (Concentrate)
RA0506-C.5 0.5 mL

HCG-beta (Pregnancy & Choriocarcinoma Marker) ; Clone SPM105 (Concentrate)

Sign In for Pricing
View Details
Lrrc75b Mouse shRNA Plasmid (Locus ID 192734)
TR506189 1 Kit

Lrrc75b Mouse shRNA Plasmid (Locus ID 192734)

Sign In for Pricing
View Details
Human EDDM3A activation kit by CRISPRa
GA107449 1 Kit

Human EDDM3A activation kit by CRISPRa

Sign In for Pricing
View Details
Mouse 50% complement hemolysis (CH50) ELISA Kit
201-02-0293 96 Tests

Mouse 50% complement hemolysis (CH50) ELISA Kit

Sign In for Pricing
View Details
Protein S100-A10 (S100A10) Antibody
abx237552 100 µg

Protein S100-A10 (S100A10) Antibody

Sign In for Pricing
View Details
Olfr513 sgRNA CRISPR Lentivector (Mouse) (Target 1)
K4245602 1.0 µg DNA

Olfr513 sgRNA CRISPR Lentivector (Mouse) (Target 1)

Sign In for Pricing
View Details