Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Serine/arginine-rich splicing factor 9 (SRSF9)

This Recombinant Human Serine/arginine-rich splicing factor 9 (SRSF9) spans the amino acid sequence from region 1-221aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Pre-mRNA-splicing factor SRp30C; Splicing factor, arginine/serine-rich 9

UniProt

Q13242

Expression Region

1-221aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.5 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MSGWADERGGEGDGRIYVGNLPTDVREKDLEDLFYKYGRIREIELKNRHGLVPFAFVRFEDPRDAEDAIYGRNGYDYGQCRLRVEFPRTYGGRGGWPRGGRNGPPTRRSDFRVLVSGLPPSGSWQDLKDHMREAGDVCYADVQKDGVGMVEYLRKEDMEYALRKLDDTKFRSHEGETSYIRVYPERSTSYGYSRSRSGSRGRDSPYQSRGSPHYFSPFRPY

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant Human GCGR VLP
WHM-GC083 100 µg, 1 mg

Recombinant Human GCGR VLP

Sign In for Pricing
View Details
Anti-Protein Kinase B Alpha (PKBA)
FY-AB49518-01 1 mL

Anti-Protein Kinase B Alpha (PKBA)

Sign In for Pricing
View Details
Anti-Protein Kinase B Alpha (PKBA)
FY-AB49518-02 100 µL

Anti-Protein Kinase B Alpha (PKBA)

Sign In for Pricing
View Details
Anti-Protein Kinase B Alpha (PKBA)
FY-AB49518-03 200 µL

Anti-Protein Kinase B Alpha (PKBA)

Sign In for Pricing
View Details
Olr836 3'UTR Lenti-reporter-Luc Vector
34725086 1.0 µg

Olr836 3'UTR Lenti-reporter-Luc Vector

Sign In for Pricing
View Details
Anticancer agent 131
MBS5824740 Inquire

Anticancer agent 131

Sign In for Pricing
View Details