Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Syntaxin-17 (Stx17), partial

This Recombinant Mouse Syntaxin-17 (Stx17), partial spans the amino acid sequence from region 2-227aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Stx17

UniProt

Q9D0I4

Expression Region

2-227aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Cell Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

32.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SEDEEKVKLRRLEPAIQKFTKIVIPTDLERLRKHQINIEKYQRCRIWDKLHEEHINAGRTVQQLRSNIREMEKLCLKVHKDDLVLLKRMIDPVKEAAATATAEFLQLHLESVEELKKQVNDEELLQPSLTRSTTVDGVLHTGEAEAASQSLTQIYALPEIPQDQNAAESWETLEADLIELSHLVTDMSLLVSSQQEKIDSIADHVNSAAVNVEEGTKNLQKAAKYK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Multiplex Assay Kit for Peptide YY (PYY), etc. by FLIA (Flow Luminescence Immunoassay)
TRV-0027559 96 Tests

Multiplex Assay Kit for Peptide YY (PYY), etc. by FLIA (Flow Luminescence Immunoassay)

Sign In for Pricing
View Details
GATA1 Antibody
CSB-PA009274LA01HU-01 50 µg

GATA1 Antibody

Sign In for Pricing
View Details
GATA1 Antibody
CSB-PA009274LA01HU-02 100 µg

GATA1 Antibody

Sign In for Pricing
View Details
Beta Tubulin Antibody (YA839, Mouse)
HY-P80955-01 20 µL

Beta Tubulin Antibody (YA839, Mouse)

Sign In for Pricing
View Details
Beta Tubulin Antibody (YA839, Mouse)
HY-P80955-02 50 μL

Beta Tubulin Antibody (YA839, Mouse)

Sign In for Pricing
View Details
Beta Tubulin Antibody (YA839, Mouse)
HY-P80955-03 100 µL

Beta Tubulin Antibody (YA839, Mouse)

Sign In for Pricing
View Details