Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Protein-glutamine gamma-glutamyltransferase K (TGM1), partial

This Recombinant Human Protein-glutamine gamma-glutamyltransferase K (TGM1), partial spans the amino acid sequence from region 579-787aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Epidermal TGase; Transglutaminase K; Transglutaminase-1

UniProt

P22735

Expression Region

579-787aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Pharmacology & Drug Discovery

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

29.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

VAMQVEAQDAVMGQDLMVSVMLINHSSSRRTVKLHLYLSVTFYTGVSGTIFKETKKEVELAPGASDRVTMPVAYKEYRPHLVDQGAMLLNVSGHVKESGQVLAKQHTFRLRTPDLSLTLLGAAVVGQECEVQIVFKNPLPVTLTNVVFRLEGSGLQRPKILNVGDIGGNETVTLRQSFVPVRPGPRQLIASLDSPQLSQVHGVIQVDVA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse CLEC1B Recombinant Protein
PPT-16457 100 µg

Mouse CLEC1B Recombinant Protein

Sign In for Pricing
View Details
PPIAP3 AAV siRNA Pooled Vector
37349161 1.0 µg

PPIAP3 AAV siRNA Pooled Vector

Sign In for Pricing
View Details
KPNA3 (NM_002267) Human Tagged ORF Clone
RC207314 10 µg

KPNA3 (NM_002267) Human Tagged ORF Clone

Sign In for Pricing
View Details
GIMAP5 Polyclonal Antibody
E44H04819 100 µL

GIMAP5 Polyclonal Antibody

Sign In for Pricing
View Details
Magic™ Membrane Protein Human SLC6A15 (Solute carrier family 6 member 15) Full Length
MPC0903K Each

Magic™ Membrane Protein Human SLC6A15 (Solute carrier family 6 member 15) Full Length

Sign In for Pricing
View Details
LINC00471 ORF Vector (Human) (pORF)
26774011 1.0 µg DNA

LINC00471 ORF Vector (Human) (pORF)

Sign In for Pricing
View Details