Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Versican core protein (Vcan), partial

This Recombinant Mouse Versican core protein (Vcan), partial spans the amino acid sequence from region 24-146aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chondroitin sulfate proteoglycan core protein 2; Large fibroblast proteoglycan; PG-M

UniProt

Q62059

Expression Region

24-146aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CLP Recombinant Rabbit monoclonal Antibody
HA750748 100 µL

CLP Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details
CD20 (B9E9), CF594 conjugate, 0.1mg/mL
BNC940160-100 1x 100 µL

CD20 (B9E9), CF594 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
HDAC11 (NM_024827) Human Over-expression Lysate
LY403040 100 µg

HDAC11 (NM_024827) Human Over-expression Lysate

Sign In for Pricing
View Details
Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF568 conjugate, 0.1mg/mL
BNC681387-500 1x 500 µL

Ferritin, Light Chain (FTL) (Microglia Marker) (FTL/1387), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Tissue FFPE Sections, Brain
CS703362 5x 5 µm

Tissue FFPE Sections, Brain

Sign In for Pricing
View Details
PLAAT4 Human Gene Knockout Kit (CRISPR)
KN401923 1 Kit

PLAAT4 Human Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details