Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Versican core protein (Vcan), partial

This Recombinant Mouse Versican core protein (Vcan), partial spans the amino acid sequence from region 24-146aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Chondroitin sulfate proteoglycan core protein 2; Large fibroblast proteoglycan; PG-M

UniProt

Q62059

Expression Region

24-146aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Mus musculus (Mouse)

Field of Research

Signal Transduction

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

AKMETSPPVKGSLSGKVVLPCHFSTLPTLPPNYNTSEFLRIKWSKMEVDKNGKDIKETTVLVAQNGNIKIGQDYKGRVSVPTHPDDVGDASLTMVKLRASDAAVYRCDVMYGIEDTQDTMSLA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Helt sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)
K3622707 1.0 µg DNA

Helt sgRNA CRISPR/Cas9 All-in-One Lentivector (Mouse) (Target 2)

Sign In for Pricing
View Details
Recombinant Human CELA1 Protein - (Dry Ice)
H00001990-P01-10ug 10 µg

Recombinant Human CELA1 Protein - (Dry Ice)

Sign In for Pricing
View Details
Cytokeratin 10 Rabbit Monoclonal Antibody
AF1861 50 µL

Cytokeratin 10 Rabbit Monoclonal Antibody

Sign In for Pricing
View Details
Gm5921 3'UTR GFP Stable Cell Line
TU158324 1.0 mL

Gm5921 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Human CD178 / FAS Ligand ELISA Kit
M869080010 10x 96 Well

Human CD178 / FAS Ligand ELISA Kit

Sign In for Pricing
View Details
ADSSL1 Protein Vector (Human) (pPM-N-D-C-His)
PV320261 500 ng

ADSSL1 Protein Vector (Human) (pPM-N-D-C-His)

Sign In for Pricing
View Details