Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Vpr (vpr)

This Recombinant Human immunodeficiency virus type 1 group M subtype B Protein Vpr (vpr) spans the amino acid sequence from region 1-96aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

R ORF protein; Viral protein R

UniProt

P12520

Expression Region

1-96aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Human immunodeficiency virus type 1 group M subtype B (isolate NY5) (HIV-1)

Field of Research

Infectious Disease & Virology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

18.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEQAPEDQGPQREPYNEWTLELLEELKSEAVRHFPRIWLHNLGQHIYETYGDTWAGVEAIIRILQQLLFIHFRIGCRHSRIGVTRQRRARNGASRS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit
GA-E0068BV-01 48 Tests

Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit

Sign In for Pricing
View Details
Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit
GA-E0068BV-02 96 Tests

Bovine Macrophage Inflammatory Protein 3 Alpha (MIP3a) ELISA Kit

Sign In for Pricing
View Details
PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (MaxLight 750)
MBS6389898-01 0.1 mL

PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (MaxLight 750)

Sign In for Pricing
View Details
PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (MaxLight 750)
MBS6389898-02 5x 0.1 mL

PLXDC1 (TEM3, TEM7, Plexin Domain-containing Protein 1, Tumor Endothelial Marker 3, Tumor Endothelial Marker 7, DKFZp686F0937, FLJ36270, FLJ45632) (MaxLight 750)

Sign In for Pricing
View Details
ENSA Protein Vector (Mouse) (pPB-C-His)
PV175742 500 ng

ENSA Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
Rat Serpin A11 ELISA Kit
MBS2884593-01 48 Well

Rat Serpin A11 ELISA Kit

Sign In for Pricing
View Details