Recombinant Escherichia coli Low molecular weight protein-tyrosine-phosphatase Wzb (wzb), Biotinylated
Selected Variant
GTR19122780-01
Size: 20 µg
This Recombinant Escherichia coli Low molecular weight protein-tyrosine-phosphatase Wzb (wzb), Biotinylated spans the amino acid sequence from region 1-147aa. Purity: Greater than 85% as determined by SDS-PAGE.
Product Specifications
Product Name Alternative
Wzb
UniProt
P0AAB2
Expression Region
1-147aa
Tag
N-terminal MBP-tagged and C-terminal 6xHis-Avi-tagged
Source
E.coli
Origin
Escherichia coli (strain K12)
Field of Research
Infectious Disease & Virology; Pharmacology & Drug Discovery
Purity
Greater than 85% as determined by SDS-PAGE.
Form
Liquid or Lyophilized powder
Molecular Weight
64.4 kDa
Storage Conditions
The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.
Notes
For research use only.
Applications Notes
We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
Preservative
If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
AA Sequence
MFNNILVVCVGNICRSPTAERLLQRYHPELKVESAGLGALVGKGADPTAISVAAEHQLSLEGHCARQISRRLCRNYDLILTMEKRHIERLCEMAPEMRGKVMLFGHWDNECEIPDPYRKSRETFAAVYTLLERSARQWAQALNAEQV
Available Sizes
Price
Sign In for Pricing
Frequently Asked Questions
More Discoveries
Explore Other Products
Browse additional items from our catalog
BNC742224-500 1x 500 µL
S100A4 / Metastasin / Calvasculin (Marker of Tumor Metastasis) (CPTC-S100A4-3), CF740 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
PB10059-Biotin 100 µg/Vial
Anti-EpCAM Antibody Picoband® (Biotine Conjugate)
Sign In for Pricing
View Details 
BNC680265-500 1x 500 µL
Phosphotyrosine (P-Tyr) (PY265), CF568 conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNC042162-500 1x 500 µL
CD163 (Monocyte & Macrophage Marker) (M130/2162), CF405S conjugate, 0.1mg/mL
Sign In for Pricing
View Details 
BNUM1560-50 1x 50 µL
Angiotensin I Converting Enzyme (ACE) / CD143 (9B9), 1mg/mL
Sign In for Pricing
View Details 