Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Atrax robustus Delta-hexatoxin-Ar1a

This Recombinant Atrax robustus Delta-hexatoxin-Ar1a spans the amino acid sequence from region 1-42aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Delta-atracotoxin-Ar1; Delta-atracotoxin-Ar1a; Robustoxin

UniProt

P01478

Expression Region

1-42aa

Tag

N-terminal 6xHis-KSI-tagged

Source

E.coli

Origin

Atrax robustus (Sydney funnel-web spider)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

CAKKRNWCGKNEDCCCPMKCIYAWYNQQGSCQTTITGLFKKC

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CD2AP (NM_012120) Human Recombinant Protein
TP310191M 100 µg

CD2AP (NM_012120) Human Recombinant Protein

Sign In for Pricing
View Details
Mouse CD68/SR‑D1, C-His Tag (ECD)
HA211131-01 20 µg

Mouse CD68/SR‑D1, C-His Tag (ECD)

Sign In for Pricing
View Details
Mouse CD68/SR‑D1, C-His Tag (ECD)
HA211131-02 50 µg

Mouse CD68/SR‑D1, C-His Tag (ECD)

Sign In for Pricing
View Details
Mouse CD68/SR‑D1, C-His Tag (ECD)
HA211131-03 100 µg

Mouse CD68/SR‑D1, C-His Tag (ECD)

Sign In for Pricing
View Details
GBR 12783 Dihydrochloride
TRC-G268013-5MG 5 mg

GBR 12783 Dihydrochloride

Sign In for Pricing
View Details
TNFSF13B Polyclonal Antibody
E-AB-13947-01 20 µL

TNFSF13B Polyclonal Antibody

Sign In for Pricing
View Details