Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Tachypleus tridentatus clotting factor C, partial

This Recombinant Tachypleus tridentatus clotting factor C, partial spans the amino acid sequence from region 763-1019aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Limulus factor C

UniProt

P28175

Expression Region

763-1019aa

Tag

N-terminal 6xHis-tagged

Source

E.coli

Origin

Tachypleus tridentatus (Japanese horseshoe crab)

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

35.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

IWNGNSTEIGQWPWQAGISRWLADHNMWFLQCGGSLLNEKWIVTAAHCVTYSATAEIIDPSQFKIYLGKYYRDDSRDDDYVQVREALEIHVNPNYDPGNLNFDIALIQLKTPVTLTTRVQPICLPTDITTREHLKEGTLAVVTGWGLNENNTYSEMIQQAVLPVVAASTCEEGYKEADLPLTVTENMFCAGYKKGRYDACSGDSGGPLVFADDSRTERRWVLEGIVSWGSPSGCGKANQYGGFTKVNVFLSWIRQFI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Lauryl glucose neopentyl glycol
257456-01 250 mg

Lauryl glucose neopentyl glycol

Sign In for Pricing
View Details
Lauryl glucose neopentyl glycol
257456-02 500 mg

Lauryl glucose neopentyl glycol

Sign In for Pricing
View Details
Lauryl glucose neopentyl glycol
257456-03 1 g

Lauryl glucose neopentyl glycol

Sign In for Pricing
View Details
Lauryl glucose neopentyl glycol
257456-04 2 g

Lauryl glucose neopentyl glycol

Sign In for Pricing
View Details
Lauryl glucose neopentyl glycol
257456-05 5 g

Lauryl glucose neopentyl glycol

Sign In for Pricing
View Details
MN1 Antibody - C-terminal region
ARP63590_P050-25UL 25 µL

MN1 Antibody - C-terminal region

Sign In for Pricing
View Details