Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Naja atra Acidic phospholipase A2 2

This Recombinant Naja atra Acidic phospholipase A2 2 spans the amino acid sequence from region 28-146aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Phosphatidylcholine 2-acylhydrolase

UniProt

Q91133

Expression Region

28-146aa

Tag

C-terminal 6xHis-tagged

Source

E.coli

Origin

Naja atra (Chinese cobra)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NLYQFKNMIQCTVPSRSWWDFADYGCYCGRGGSGTPVDDLDRCCQVHDHCYNEAEKISGCWPYSKTYSYECSQGTLTCKGGNNACAAAVCDCDRLAAICFAGAPYNNNNYNIDLKARCQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

SNORD56 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)
K2230208 1.0 µg DNA

SNORD56 sgRNA CRISPR/Cas9 All-in-One Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
BRS3 (Bombesin Receptor Subtype-3, Bombesin Like Receptor 3)
476389 100 µL

BRS3 (Bombesin Receptor Subtype-3, Bombesin Like Receptor 3)

Sign In for Pricing
View Details
Immortalized Rabbit Liver Mesenchymal Cell
ARI0191 1 Million

Immortalized Rabbit Liver Mesenchymal Cell

Sign In for Pricing
View Details
GTF2H1, NT (GTF2H1, BTF2, General transcription factor IIH subunit 1, Basic transcription factor 2 62kD subunit, General transcription factor IIH polypeptide 1, TFIIH basal transcription factor complex p62 subunit) (MaxLight 550) discontinued
036358-ML550 100 µL

GTF2H1, NT (GTF2H1, BTF2, General transcription factor IIH subunit 1, Basic transcription factor 2 62kD subunit, General transcription factor IIH polypeptide 1, TFIIH basal transcription factor complex p62 subunit) (MaxLight 550) discontinued

Sign In for Pricing
View Details
POU3F1 Antibody
42-943 0.1 mg

POU3F1 Antibody

Sign In for Pricing
View Details
LILRA2 Polyclonal Antibody
A59622-020 20 µL

LILRA2 Polyclonal Antibody

Sign In for Pricing
View Details