Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Seizure protein 6 homolog (SEZ6), partial

This Recombinant Human Seizure protein 6 homolog (SEZ6), partial spans the amino acid sequence from region 355-414aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEZ-6; hSEZ-6; SEZ6

UniProt

Q53EL9

Expression Region

355-414aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

14.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LSCHFPRRPAYGDVTVTSLHPGGSARFHCATGYQLKGARHLTCLNATQPFWDSKEPVCIA

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) arcB Polyclonal Antibody
MBS9002506 Inquire

Rabbit anti-Escherichia coli O6:H1 (strain CFT073/700928/UPEC) arcB Polyclonal Antibody

Sign In for Pricing
View Details
SLC4A5 Polyclonal Antibody
orb1417811 100 µL

SLC4A5 Polyclonal Antibody

Sign In for Pricing
View Details
Goat anti-Human Hemoglobin Antibody Biotinylated
A80-134B 1 mg

Goat anti-Human Hemoglobin Antibody Biotinylated

Sign In for Pricing
View Details
Pftk1 (BC068134) Mouse Tagged ORF Clone Lentiviral Particle
MR206736L3V 200 µL

Pftk1 (BC068134) Mouse Tagged ORF Clone Lentiviral Particle

Sign In for Pricing
View Details
Coagulation Factor VIII (F8) BioAssayTM ELISA Kit (Human)
529941 96 Tests

Coagulation Factor VIII (F8) BioAssayTM ELISA Kit (Human)

Sign In for Pricing
View Details
Micropipette 2-20 µL, Pipettor adjustable single channel
43221024-1 1 Each

Micropipette 2-20 µL, Pipettor adjustable single channel

Sign In for Pricing
View Details