Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Seizure protein 6 homolog (SEZ6), partial

This Recombinant Human Seizure protein 6 homolog (SEZ6), partial spans the amino acid sequence from region 415-527aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

SEZ-6; hSEZ-6; SEZ6

UniProt

Q53EL9

Expression Region

415-527aa

Tag

C-terminal 10xHis-tagged

Source

E.coli

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

ACGGVIRNATTGRIVSPGFPGNYSNNLTCHWLLEAPEGQRLHLHFEKVSLAEDDDRLIIRNGDNVEAPPVYDSYEVEYLPIEGLLSSGKHFFVELSTDSSGAAAGMALRYEAF

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

(2R,5R)-1,6-Diphenylhexane-2,5-diamine Dihydrochloride
TRC-D495498-500MG 500 mg

(2R,5R)-1,6-Diphenylhexane-2,5-diamine Dihydrochloride

Sign In for Pricing
View Details
IRF7 (C-term) Rabbit Polyclonal Antibody
AP07762PU-N 50 µg

IRF7 (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
Ginkgolide B
TRC-G387430-50MG 50 mg

Ginkgolide B

Sign In for Pricing
View Details
Human MDFIC activation kit by CRISPRa
GA109350 1 Kit

Human MDFIC activation kit by CRISPRa

Sign In for Pricing
View Details
Melatonin-d4
TRC-M215002-50MG 50 mg

Melatonin-d4

Sign In for Pricing
View Details
CD9 Recombinant Rabbit monoclonal Antibody
HA750027 100 µL

CD9 Recombinant Rabbit monoclonal Antibody

Sign In for Pricing
View Details