Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Neurogenin-2 (NEUROG2)

This Recombinant Human Neurogenin-2 (NEUROG2) spans the amino acid sequence from region 1-272aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Class A basic helix-loop-helix protein 8; Protein atonal homolog 4

UniProt

Q9H2A3

Expression Region

1-272aa

Tag

C-terminal 10xHis-HSA-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

96.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MFVKSETLELKEEEDVLVLLGSASPALAALTPLSSSADEEEEEEPGASGGARRQRGAEAGQGARGGVAAGAEGCRPARLLGLVHDCKRRPSRARAVSRGAKTAETVQRIKKTRRLKANNRERNRMHNLNAALDALREVLPTFPEDAKLTKIETLRFAHNYIWALTETLRLADHCGGGGGGLPGALFSEAVLLSPGGASAALSSSGDSPSPASTWSCTNSPAPSSSVSSNSTSPYSCTLSPASPAGSDMDYWQPPPPDKHRYAPHLPIARDCI

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Rabbit IgG (Fcγ Fragment specific), AlpHcAbs® Goat antibody
HA710048 100 µg

Rabbit IgG (Fcγ Fragment specific), AlpHcAbs® Goat antibody

Sign In for Pricing
View Details
L Kynurenine Hydrolase (KYNU) (C-term) Rabbit Polyclonal Antibody
AP17533PU-N 400 µL

L Kynurenine Hydrolase (KYNU) (C-term) Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
3-Cyanopropionaldehyde Diethyl Acetal
TRC-C987630-25G 25 g

3-Cyanopropionaldehyde Diethyl Acetal

Sign In for Pricing
View Details
Benzalkonium Chloride
TRC-B183550-2.5G 2.5 g

Benzalkonium Chloride

Sign In for Pricing
View Details
MARCH3 Antibody
8C15548-AAT 50 µg

MARCH3 Antibody

Sign In for Pricing
View Details
BFSP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B7]
TA804359BM 100 µL

BFSP2 Mouse Monoclonal Antibody (HRP conjugated) [Clone ID: OTI2B7]

Sign In for Pricing
View Details