Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Nectin-2 (NECTIN2), partial

This Recombinant Human Nectin-2 (NECTIN2), partial spans the amino acid sequence from region 32-360aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Herpes virus entry mediator B; Nectin cell adhesion molecule 2; Poliovirus receptor-related protein 2

UniProt

Q92692

Expression Region

32-360aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

QDVRVQVLPEVRGQLGGTVELPCHLLPPVPGLYISLVTWQRPDAPANHQNVAAFHPKMGPSFPSPKPGSERLSFVSAKQSTGQDTEAELQDATLALHGLTVEDEGNYTCEFATFPKGSVRGMTWLRVIAKPKNQAEAQKVTFSQDPTTVALCISKEGRPPARISWLSSLDWEAKETQVSGTLAGTVTVTSRFTLVPSGRADGVTVTCKVEHESFEEPALIPVTLSVRYPPEVSISGYDDNWYLGRTDATLSCDVRSNPEPTGYDWSTTSGTFPTSAVAQGSQLVIHAVDSLFNTTFVCTVTNAVGMGRAEQVIFVRETPRASPRDVGPL

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Porcine Keratin 19 ELISA Kit
MBS101863-01 48 Well

Porcine Keratin 19 ELISA Kit

Sign In for Pricing
View Details
Porcine Keratin 19 ELISA Kit
MBS101863-02 96 Well

Porcine Keratin 19 ELISA Kit

Sign In for Pricing
View Details
Porcine Keratin 19 ELISA Kit
MBS101863-03 5x 96 Well

Porcine Keratin 19 ELISA Kit

Sign In for Pricing
View Details
Porcine Keratin 19 ELISA Kit
MBS101863-04 10x 96 Well

Porcine Keratin 19 ELISA Kit

Sign In for Pricing
View Details
anti-KIT (1C5)
LF-MA30622 100 ul

anti-KIT (1C5)

Sign In for Pricing
View Details
CHO-K1/MT1/Gα15 Stable Cell Line
M00424 2 Vials

CHO-K1/MT1/Gα15 Stable Cell Line

Sign In for Pricing
View Details