Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca mulatta Erythropoietin receptor (EPOR), partial

This Recombinant Macaca mulatta Erythropoietin receptor (EPOR), partial spans the amino acid sequence from region 26-250aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

EPOR

UniProt

F7GNY3

Expression Region

26-250aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Macaca mulatta (Rhesus macaque)

Field of Research

Cancer Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

52.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

PPPNLPDPKFESKAALLVARGPEELLCFTERLEDLVCFWEEAASAGVSPDNYSFSYHLEDEPWKLCRLHQAPTARGAVRFWCSLPTADTSSFVPLELRVTAASGAPRYHRIIHINEVVLLDAPVGLVARLADEGGHIVLRWLPPPEAPMTSHIRYEVDVSAGNGAGSVQRVEILEGRTECVLSNLRGRTRYTFAVRARMAEPSFGGFWSAWSEPVSLLTPSDLDP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ECEL1 Protein Vector (Mouse) (pPB-C-His)
PV174310 500 ng

ECEL1 Protein Vector (Mouse) (pPB-C-His)

Sign In for Pricing
View Details
CDY1 3'UTR GFP Stable Cell Line
TU054127 1.0 mL

CDY1 3'UTR GFP Stable Cell Line

Sign In for Pricing
View Details
Rabbit Anti-Human BMP-1 Polyclonal Antibody
PA85112HU-01 50 µg

Rabbit Anti-Human BMP-1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human BMP-1 Polyclonal Antibody
PA85112HU-02 100 µg

Rabbit Anti-Human BMP-1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human BMP-1 Polyclonal Antibody
PA85112HU-03 500 µg

Rabbit Anti-Human BMP-1 Polyclonal Antibody

Sign In for Pricing
View Details
Rabbit Anti-Human BMP-1 Polyclonal Antibody
PA85112HU-04 1 mg

Rabbit Anti-Human BMP-1 Polyclonal Antibody

Sign In for Pricing
View Details