Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial, Biotinylated

This Recombinant Human T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial, Biotinylated spans the amino acid sequence from region 23-126aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-cell surface antigen T3/Leu-4 epsilon chain

UniProt

P07766

Expression Region

23-126aa

Tag

C-terminal 10xHis-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Capzb activation kit by CRISPRa
GA200522 1 Kit

Mouse Capzb activation kit by CRISPRa

Sign In for Pricing
View Details
Frozen Tissue Sections, Colon: right
CS636822 5x 5 µm

Frozen Tissue Sections, Colon: right

Sign In for Pricing
View Details
Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF568 conjugate, 0.1mg/mL
BNC681725-500 1x 500 µL

Glycophorin A / CD235a (Erythrocyte Marker) (GYPA/1725R), CF568 conjugate, 0.1mg/mL

Sign In for Pricing
View Details
Petroleum Ether
TRC-P293505-50ML 50 mL

Petroleum Ether

Sign In for Pricing
View Details
Gpc1 Mouse Gene Knockout Kit (CRISPR)
KN307154BN 1 Kit

Gpc1 Mouse Gene Knockout Kit (CRISPR)

Sign In for Pricing
View Details
Purified Anti-Mouse CD22 Antibody[Cy34.1]
E-AB-F1021A-01 25 µg

Purified Anti-Mouse CD22 Antibody[Cy34.1]

Sign In for Pricing
View Details