Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial, Biotinylated

This Recombinant Human T-cell surface glycoprotein CD3 epsilon chain (CD3E), partial, Biotinylated spans the amino acid sequence from region 23-126aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-cell surface antigen T3/Leu-4 epsilon chain

UniProt

P07766

Expression Region

23-126aa

Tag

C-terminal 10xHis-Avi-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

15.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

DGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQHNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCENCMEMD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Bovine Glomerular basement membrane antibody ELISA Kit
OM620241 96 Strip Well

Bovine Glomerular basement membrane antibody ELISA Kit

Sign In for Pricing
View Details
OR2T8 (NM_001005522) Human Untagged Clone
SC300998 10 µg

OR2T8 (NM_001005522) Human Untagged Clone

Sign In for Pricing
View Details
Rat Apelin Receptor (APLNR) ELISA Kit
orb1946899-01 48 Tests

Rat Apelin Receptor (APLNR) ELISA Kit

Sign In for Pricing
View Details
Rat Apelin Receptor (APLNR) ELISA Kit
orb1946899-02 96 Tests

Rat Apelin Receptor (APLNR) ELISA Kit

Sign In for Pricing
View Details
Galactosidase alpha Rabbit pAb, PerCP-Cy7 conjugated
orb2820092 100 µL

Galactosidase alpha Rabbit pAb, PerCP-Cy7 conjugated

Sign In for Pricing
View Details
CD45RA antibody
45RAPP2-100T 100 Tests

CD45RA antibody

Sign In for Pricing
View Details