Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD8 alpha&beta Heterodimer Protein (CD8A&CD8B)

This Recombinant Human T-cell surface glycoprotein CD8 alpha&beta Heterodimer Protein (CD8A&CD8B) spans the amino acid sequence from region 1-182aa&22-170aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

UniProt

P01732, P10966

Expression Region

1-182aa&22-170aa

Tag

C-terminal 10xHis-tagged&C-terminal Twin-Strep-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

19.8 kDa&19.8 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MALPVTALLLPLALLLHAARPSQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD&LQQTPAYIKVQTNKMVMLSCEAKISLSNMRIYWLRQRQAPSSDSHHEFLALWDSAKGTIHGEEVEQEKIAVFRDASRFILNLTSVKPEDSGIYFCMIVGSPELTFGKGTQLSVVDFLPTTAQPTKKSTLKKRVCRLPRPETQKGPLCSP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

CYP2S1 Antibody
orb2626376 100 µL

CYP2S1 Antibody

Sign In for Pricing
View Details
Polyclonal Goat Anti-HTR7 / 5-HT7 Antibody
AMM05018G 0.1 mg

Polyclonal Goat Anti-HTR7 / 5-HT7 Antibody

Sign In for Pricing
View Details
2-Cyclopropyl-3- (pyrrolidin-1-yl) propan-1-amine
UAD75722-01 50 mg

2-Cyclopropyl-3- (pyrrolidin-1-yl) propan-1-amine

Sign In for Pricing
View Details
2-Cyclopropyl-3- (pyrrolidin-1-yl) propan-1-amine
UAD75722-02 0.5 g

2-Cyclopropyl-3- (pyrrolidin-1-yl) propan-1-amine

Sign In for Pricing
View Details
APC anti-human CD38
GT16681 100 Tests

APC anti-human CD38

Sign In for Pricing
View Details
VEGFR2/KDR/Flk-1 Antibody Blocking Peptide - (Dry Ice)
NB100-530PEP 0.1 mg

VEGFR2/KDR/Flk-1 Antibody Blocking Peptide - (Dry Ice)

Sign In for Pricing
View Details