Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Macaca fascicularis macrophage colony-stimulating factor 1 isoform X1 (CSF1), partial

This Recombinant Macaca fascicularis macrophage colony-stimulating factor 1 isoform X1 (CSF1), partial spans the amino acid sequence from region 25-190aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CSF1

Expression Region

25-190aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Macaca fascicularis (Crab-eating macaque) (Cynomolgus monkey)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

20.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EEVSEYCSHMIGSGHLQSLQRLIDSQMETSCQITFEFVDQEQLKDPVCYLKKAFLLVQDIMEDTMRFRDNTPNAIAIVQLQELSLRLKSCFTKDYEEHDKACVRTFYETPLQLLEKVKNVFNETKNLLDKDWNIFSKNCNNSFAECSGQDVVTKPDCNCLYPKAIP

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

ORP3 Immunizing Peptide
MBS426071-01 0.1 mg

ORP3 Immunizing Peptide

Sign In for Pricing
View Details
ORP3 Immunizing Peptide
MBS426071-02 5x 0.1 mg

ORP3 Immunizing Peptide

Sign In for Pricing
View Details
Recombinant Human ATG2B Protein, N-His
orb2962604-01 50 µg

Recombinant Human ATG2B Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ATG2B Protein, N-His
orb2962604-02 100 µg

Recombinant Human ATG2B Protein, N-His

Sign In for Pricing
View Details
Recombinant Human ATG2B Protein, N-His
orb2962604-03 1 mg

Recombinant Human ATG2B Protein, N-His

Sign In for Pricing
View Details
GDNF
100-030-L50 50 µg

GDNF

Sign In for Pricing
View Details