Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Insulin-like growth factor-binding protein 3 receptor (TMEM219), partial

This Recombinant Human Insulin-like growth factor-binding protein 3 receptor (TMEM219), partial spans the amino acid sequence from region 39-204aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Transmembrane protein 219

UniProt

Q86XT9

Expression Region

39-204aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research; Stem Cell & Developmental Biology; Cell Biology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

46.6 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SFLLTHRTGLRSPDIPQDWVSFLRSFGQLTLCPRNGTVTGKWRGSHVVGLLTTLNFGDGPDRNKTRTFQATVLGSQMGLKGSSAGQLVLITARVTTERTAGTCLYFSAVPGILPSSQPPISCSEEGAGNATLSPRMGEECVSVWSHEGLVLTKLLTSEELALCGSR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Beta crystallin S (CRYGS) activation kit by CRISPRa
GA101003 1 Kit

Human Beta crystallin S (CRYGS) activation kit by CRISPRa

Sign In for Pricing
View Details
KIR2DL4 Antibody - middle region : FITC (ARP42025_P050-FITC)
ARP42025_P050-FITC 100 µL

KIR2DL4 Antibody - middle region : FITC (ARP42025_P050-FITC)

Sign In for Pricing
View Details
CDH17 Protein Vector (Mouse) (pPM-C-HA)
PV163960 500 ng

CDH17 Protein Vector (Mouse) (pPM-C-HA)

Sign In for Pricing
View Details
6- (4-Chlorophenyl) -3-methyl-[1,2]oxazolo[5,4-b]pyridine-4-carboxylic acid
DFB46845-01 100 mg

6- (4-Chlorophenyl) -3-methyl-[1,2]oxazolo[5,4-b]pyridine-4-carboxylic acid

Sign In for Pricing
View Details
6- (4-Chlorophenyl) -3-methyl-[1,2]oxazolo[5,4-b]pyridine-4-carboxylic acid
DFB46845-02 1 g

6- (4-Chlorophenyl) -3-methyl-[1,2]oxazolo[5,4-b]pyridine-4-carboxylic acid

Sign In for Pricing
View Details
Canine LYR motif-containing protein 5 (LYRM5) ELISA Kit
MBS7206394-01 48 Well

Canine LYR motif-containing protein 5 (LYRM5) ELISA Kit

Sign In for Pricing
View Details