Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A), partial

This Recombinant Human Sodium channel protein type 1 subunit alpha (SCN1A), partial spans the amino acid sequence from region 1-128aa. Purity: Greater than 85% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Sodium channel protein brain I subunit alpha; Sodium channel protein type I subunit alpha; Voltage-gated sodium channel subunit alpha Nav1.1

UniProt

P35498

Expression Region

1-128aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 85% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

43.4 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

MEQTVLVPPGPDSFNFFTRESLAAIERRIAEEKAKNPKPDKKDDDENGPKPNSDLEAGKNLPFIYGDIPPEMVSEPLEDLDPYYINKKTFIVLNKGKAIFRFSATSALYILTPFNPLRKIAIKILVHS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Cyclopentylacetic Acid
TRC-C989845-5G 5 g

Cyclopentylacetic Acid

Sign In for Pricing
View Details
Ethyl 2,3-Di-O-benzyl-4,6-O-benzylidene-1-deoxy-1-thio-alpha-D-mannopyranoside S-Oxide
TRC-E915775-50MG 50 mg

Ethyl 2,3-Di-O-benzyl-4,6-O-benzylidene-1-deoxy-1-thio-alpha-D-mannopyranoside S-Oxide

Sign In for Pricing
View Details
QuantiChrom™ Chloride Assay Kit
DICL-250 250 Tests

QuantiChrom™ Chloride Assay Kit

Sign In for Pricing
View Details
7-Hydroxy-1-indanone
TRC-H953823-50MG 50 mg

7-Hydroxy-1-indanone

Sign In for Pricing
View Details
CD5 Rabbit Polyclonal Antibody
TA374465 100 µL

CD5 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
XIAP (NM_001167) Human Over-expression Lysate
LY420092 100 µg

XIAP (NM_001167) Human Over-expression Lysate

Sign In for Pricing
View Details