Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Cytochrome c oxidase subunit 1 (MT-CO1), partial

This Recombinant Human Cytochrome c oxidase subunit 1 (MT-CO1), partial spans the amino acid sequence from region 474-513aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Cytochrome c oxidase polypeptide I

UniProt

P00395

Expression Region

474-513aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Neuroscience

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

33.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

EAFASKRKVLMVEEPSMNLEWLYGCPPPYHTFEEPVYMKS

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human Anti-Aflibercept antibody ELISA Kit
EH5135 96 Tests

Human Anti-Aflibercept antibody ELISA Kit

Sign In for Pricing
View Details
(S) -L-DABA (dihydrochloride)
HY-W010018-01 5 g

(S) -L-DABA (dihydrochloride)

Sign In for Pricing
View Details
(S) -L-DABA (dihydrochloride)
HY-W010018-02 10 g

(S) -L-DABA (dihydrochloride)

Sign In for Pricing
View Details
Goat Anti-Human IgG Fc - HRP
orb1786826-01 100 µL

Goat Anti-Human IgG Fc - HRP

Sign In for Pricing
View Details
Goat Anti-Human IgG Fc - HRP
orb1786826-02 500 µL

Goat Anti-Human IgG Fc - HRP

Sign In for Pricing
View Details
DUSP24 Antibody Blocking peptide
orb1444762 500 µg

DUSP24 Antibody Blocking peptide

Sign In for Pricing
View Details