Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Bovine Regakine-1

This Recombinant Bovine Regakine-1 spans the amino acid sequence from region 22-92aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

UniProt

P82943

Expression Region

22-92aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Bos taurus (Bovine)

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

37.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

NEEPAGNMRVCCFSSVTRKIPLSLVKNYERTGDKCPQEAVIFQTRSGRSICANPGQAWVQKYIEYLDQMSK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Recombinant S100 alpha9 Antibody
RC-15516-01 50 μL

Recombinant S100 alpha9 Antibody

Sign In for Pricing
View Details
Recombinant S100 alpha9 Antibody
RC-15516-02 100 µL

Recombinant S100 alpha9 Antibody

Sign In for Pricing
View Details
Recombinant S100 alpha9 Antibody
RC-15516-03 1 mL

Recombinant S100 alpha9 Antibody

Sign In for Pricing
View Details
SEL1L3 (NM_015187) Human Over-expression Lysate
LY402418 100 µg

SEL1L3 (NM_015187) Human Over-expression Lysate

Sign In for Pricing
View Details
SCML1 Rabbit Polyclonal Antibody
TA381286 100 µL

SCML1 Rabbit Polyclonal Antibody

Sign In for Pricing
View Details
CD79b (B-Cell Marker) (B29/123), CF640R conjugate, 0.1mg/mL
BNC403107-500 1x 500 µL

CD79b (B-Cell Marker) (B29/123), CF640R conjugate, 0.1mg/mL

Sign In for Pricing
View Details