Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Vaccinia virus Protein OPG190 (OPG190), partial

This Recombinant Vaccinia virus Protein OPG190 (OPG190), partial spans the amino acid sequence from region 18-279aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Plaque-size/host range protein

UniProt

Q01227

Expression Region

18-279aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Vaccinia virus (strain Western Reserve) (VACV) (Vaccinia virus (strain WR) )

Field of Research

Infectious Disease & Virology

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

31.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

YSTCTVPTMNNAKLTSTETSFNDKQKVTFTCDQGYHSSDPNAVCETDKWKYENPCKKMCTVSDYISELYNKPLYEVNSTMTLSCNGETKYFRCEEKNGNTSWNDTVTCPNAECQPLQLEHGSCQPVKEKYSFGEYMTINCDVGYEVIGASYISCTANSWNVIPSCQQKCDMPSLSNGLISGSTFSIGGVIHLSCKSGFTLTGSPSSTCIDGKWNPVLPICVRTNEEFDPVDDGPDDETDLSKLSKDVVQYEQEIESLEATYH

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

3- (Piperazin-1-ylmethyl) phenol dihydrochloride
FP122680-01 250 mg

3- (Piperazin-1-ylmethyl) phenol dihydrochloride

Sign In for Pricing
View Details
3- (Piperazin-1-ylmethyl) phenol dihydrochloride
FP122680-02 500 mg

3- (Piperazin-1-ylmethyl) phenol dihydrochloride

Sign In for Pricing
View Details
3- (Piperazin-1-ylmethyl) phenol dihydrochloride
FP122680-03 1000 mg

3- (Piperazin-1-ylmethyl) phenol dihydrochloride

Sign In for Pricing
View Details
3- (Piperazin-1-ylmethyl) phenol dihydrochloride
FP122680-04 2000 mg

3- (Piperazin-1-ylmethyl) phenol dihydrochloride

Sign In for Pricing
View Details
PAK6 (p21 Activated Kinase 6, PAK5) (MaxLight 650)
MBS6430497-01 0.1 mL

PAK6 (p21 Activated Kinase 6, PAK5) (MaxLight 650)

Sign In for Pricing
View Details
PAK6 (p21 Activated Kinase 6, PAK5) (MaxLight 650)
MBS6430497-02 5x 0.1 mL

PAK6 (p21 Activated Kinase 6, PAK5) (MaxLight 650)

Sign In for Pricing
View Details