Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Placenta growth factor (PGF)

This Recombinant Human Placenta growth factor (PGF) spans the amino acid sequence from region 19-221aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

PlGF; PGFL, PLGF

UniProt

P49763

Expression Region

19-221aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Stem Cell & Developmental Biology

Purity

Greater than 90% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

51.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LPAVPPQQWALSAGNGSSEVEVVPFQEVWGRSYCRALERLVDVVSEYPSEVEHMFSPSCVSLLRCTGCCGDENLHCVPVETANVTMQLLKIRSGDRPSYVELTFSQHVRCECRHSPGRQSPDMPGDFRADAPSFLPPRRSLPMLFRMEWGCALTGSQSAVWPSSPVPEEIPRMHPGRNGKKQQRKPLREKMKPERCGDAVPRR

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

IGLV5-48 sgRNA CRISPR Lentivector (Human) (Target 3)
K1068104 1.0 µg DNA

IGLV5-48 sgRNA CRISPR Lentivector (Human) (Target 3)

Sign In for Pricing
View Details
MRGPRX2 Mouse mAb
E2222865 100 µL

MRGPRX2 Mouse mAb

Sign In for Pricing
View Details
skim milk powder
N7861-01 500 g

skim milk powder

Sign In for Pricing
View Details
Recombinant Rat Toll-like receptor 4(Tlr4), partial
AP78266-01 20 µg

Recombinant Rat Toll-like receptor 4(Tlr4), partial

Sign In for Pricing
View Details
Recombinant Rat Toll-like receptor 4(Tlr4), partial
AP78266-02 100 µg

Recombinant Rat Toll-like receptor 4(Tlr4), partial

Sign In for Pricing
View Details
Recombinant Human Cathepsin S/CTSS Protein, His Tag
E40KMH818 20 µg

Recombinant Human Cathepsin S/CTSS Protein, His Tag

Sign In for Pricing
View Details