Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Macrophage colony-stimulating factor 1 receptor (Csf1r), partial (Active)

This Recombinant Mouse Macrophage colony-stimulating factor 1 receptor (Csf1r), partial (Active) spans the amino acid sequence from region 20-511aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Macrophage colony-stimulating factor 1 receptor; CSF-1 receptor (CSF-1-R; CSF-1R; M-CSF-R) (EC:2.7.10.1) . EC:2.7.10.1 ; Proto-oncogene c-Fms; CD115; Csf1r; Csfmr, Fms

UniProt

P09581

Expression Region

20-511aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Endotoxin

Less than 1.0 EU/μg as determined by LAL method.

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Mouse Csf1 at 2 μg/mL can bind Mouse Csf1r. The EC50 is 3.226-4.264 ng/mL.

Form

Lyophilized powder

Molecular Weight

84.1 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

Lyophilized from a 0.2 μm sterile filtered PBS, 6% Trehalose, pH 7.4

AA Sequence

APVIEPSGPELVVEPGETVTLRCVSNGSVEWDGPISPYWTLDPESPGSTLTTRNATFKNTGTYRCTELEDPMAGSTTIHLYVKDPAHSWNLLAQEVTVVEGQEAVLPCLITDPALKDSVSLMREGGRQVLRKTVYFFSPWRGFIIRKAKVLDSNTYVCKTMVNGRESTSTGIWLKVNRVHPEPPQIKLEPSKLVRIRGEAAQIVCSATNAEVGFNVILKRGDTKLEIPLNSDFQDNYYKKVRALSLNAVDFQDAGIYSCVASNDVGTRTATMNFQVVESAYLNLTSEQSLLQEVSVGDSLILTVHADAYPSIQHYNWTYLGPFFEDQRKLEFITQRAIYRYTFKLFLNRVKASEAGQYFLMAQNKAGWNNLTFELTLRYPPEVSVTWMPVNGSDVLFCDVSGYPQPSVTWMECRGHTDRCDEAQALQVWNDTHPEVLSQKPFDKVIIQSQLPIGTLKHNMTYFCKTHNSVGNSSQYFRAVSLGQSKQLPDES

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human NR1I3 ELISA Kit
E026992 1 Each

Human NR1I3 ELISA Kit

Sign In for Pricing
View Details
Biotin anti-mouse CD182 (CXCR2)
GT05200 100 µg

Biotin anti-mouse CD182 (CXCR2)

Sign In for Pricing
View Details
Tygon Tube 3350, 3.20 x 0.80 mm
1214392 15 PK

Tygon Tube 3350, 3.20 x 0.80 mm

Sign In for Pricing
View Details
RABEP2
527531-01 100 µL

RABEP2

Sign In for Pricing
View Details
RABEP2
527531-02 200 µL

RABEP2

Sign In for Pricing
View Details
Human COX4I1 Pre-designed siRNA Set A
SI003498A 1 Each

Human COX4I1 Pre-designed siRNA Set A

Sign In for Pricing
View Details