Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Mouse Interleukin-1 receptor type 1 (Il1r1), partial

This Recombinant Mouse Interleukin-1 receptor type 1 (Il1r1), partial spans the amino acid sequence from region 20-338aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

CD121 antigen-like family member A; Interleukin-1 receptor alpha; Interleukin-1 receptor type I; p80

UniProt

P13504

Expression Region

20-338aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Mus musculus (Mouse)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Form

Liquid or Lyophilized powder

Molecular Weight

38.7 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

LEIDVCTEYPNQIVLFLSVNEIDIRKCPLTPNKMHGDTIIWYKNDSKTPISADRDSRIHQQNEHLWFVPAKVEDSGYYYCIVRNSTYCLKTKVTVTVLENDPGLCYSTQATFPQRLHIAGDGSLVCPYVSYFKDENNELPEVQWYKNCKPLLLDNVSFFGVKDKLLVRNVAEEHRGDYICRMSYTFRGKQYPVTRVIQFITIDENKRDRPVILSPRNETIEADPGSMIQLICNVTGQFSDLVYWKWNGSEIEWNDPFLAEDYQFVEHPSTKRKYTLITTLNISEVKSQFYRYPFICVVKNTNIFESAHVQLIYPVPDFK

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Mouse Nat8 activation kit by CRISPRa
GA207801 1 Kit

Mouse Nat8 activation kit by CRISPRa

Sign In for Pricing
View Details
Monobenzyl Malonate
TRC-M524880-25G 25 g

Monobenzyl Malonate

Sign In for Pricing
View Details
Human FAM20C activation kit by CRISPRa
GA111311 1 Kit

Human FAM20C activation kit by CRISPRa

Sign In for Pricing
View Details
LOC146488 Human qPCR Primer Pair (XM_047748)
HP220792 200 Reactions

LOC146488 Human qPCR Primer Pair (XM_047748)

Sign In for Pricing
View Details
n-Eicosanyl-d41 Alcohol
TRC-E501006-1MG 1 mg

n-Eicosanyl-d41 Alcohol

Sign In for Pricing
View Details
PE/Elab Fluor® 594 Anti-Mouse CD80 Antibody[16-10A1]
E-AB-F0992UP-01 25 µg

PE/Elab Fluor® 594 Anti-Mouse CD80 Antibody[16-10A1]

Sign In for Pricing
View Details