Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human Parathyroid hormone (PTH) (Active)

This Recombinant Human Parathyroid hormone (PTH) spans the amino acid sequence from region 32-115aa. Purity: Greater than 90% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

Parathyroid hormone; PTH; Parathormone; Parathyrin; PTH

UniProt

P01270

Expression Region

32-115aa

Tag

C-terminal hFc1-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Metabolism Research

Purity

Greater than 90% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA.Immobilized Human PTH1R at 5 μg/mL can bind Human PTH. The EC50 is 3.156-3.564 μg/mL.

Form

Lyophilized powder

Molecular Weight

38.3 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SVSEIQLMHNLGKHLNSMERVEWLRKKLQDVHNFVALGAPLAPRDAGSQRPRKKEDNVLVESHEKSLGEADKADVNVLTKAKSQ

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Anti-Zebrafish Collagen Type I/COL1A2 Antibody Picoband® Fluoro594 Conjugated
AZQ6IQX2-Fluoro594 100 µg/Vial

Anti-Zebrafish Collagen Type I/COL1A2 Antibody Picoband® Fluoro594 Conjugated

Sign In for Pricing
View Details
SGK2 Blocking Peptide
MBS9617893-01 1 mg

SGK2 Blocking Peptide

Sign In for Pricing
View Details
SGK2 Blocking Peptide
MBS9617893-02 5x 1 mg

SGK2 Blocking Peptide

Sign In for Pricing
View Details
Porcine Tyrosine Hydroxylase (TH) ELISA Kit
MBS263010-01 48 Well

Porcine Tyrosine Hydroxylase (TH) ELISA Kit

Sign In for Pricing
View Details
Porcine Tyrosine Hydroxylase (TH) ELISA Kit
MBS263010-02 96 Well

Porcine Tyrosine Hydroxylase (TH) ELISA Kit

Sign In for Pricing
View Details
Porcine Tyrosine Hydroxylase (TH) ELISA Kit
MBS263010-03 5x 96 Well

Porcine Tyrosine Hydroxylase (TH) ELISA Kit

Sign In for Pricing
View Details