Welcome to GenPrice! Check out our latest updates.

Shopping Cart (0)

Your cart is empty

Add some products to get started!

Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial (Active)

This Recombinant Human T-cell surface glycoprotein CD8 alpha chain (CD8A), partial spans the amino acid sequence from region 22-182aa. Purity: Greater than 95% as determined by SDS-PAGE.

Product Specifications

Product Name Alternative

T-cell surface glycoprotein CD8 alpha chain; T-lymphocyte differentiation antigen T8/Leu-2; CD8a; CD8A; MAL

UniProt

P01732

Expression Region

22-182aa

Tag

C-terminal 10xHis-tagged

Source

Mammalian cell

Origin

Homo sapiens (Human)

Field of Research

Immunology & Inflammation

Purity

Greater than 95% as determined by SDS-PAGE.

Bioactivity

Measured by its binding ability in a functional ELISA. Immobilized Human CD8A at 5 μg/mL can bind Anti-CD8A recombinant antibody. The EC50 is 11.49-20.78 ng/mL.

Form

Lyophilized powder

Molecular Weight

19.0 kDa

Storage Conditions

The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20°C/-80°C. The shelf life of lyophilized form is 12 months at -20°C/-80°C.

Notes

For research use only.

Applications Notes

We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20°C/-80°C. Our default final concentration of glycerol is 50%. Customers could use it as reference.

Preservative

If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.

AA Sequence

SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACD

Available Sizes

Frequently Asked Questions

More Discoveries

Explore Other Products

Browse additional items from our catalog

Human DEFb126 (Defensin Beta 126) ELISA Kit
ELK6682-01 48 Tests

Human DEFb126 (Defensin Beta 126) ELISA Kit

Sign In for Pricing
View Details
Human DEFb126 (Defensin Beta 126) ELISA Kit
ELK6682-02 96 Tests

Human DEFb126 (Defensin Beta 126) ELISA Kit

Sign In for Pricing
View Details
Human DEFb126 (Defensin Beta 126) ELISA Kit
ELK6682-03 5x 96 Tests

Human DEFb126 (Defensin Beta 126) ELISA Kit

Sign In for Pricing
View Details
Human Fibrillin 3 (FBN3) Protein
abx168124-01 10 µg

Human Fibrillin 3 (FBN3) Protein

Sign In for Pricing
View Details
Human Fibrillin 3 (FBN3) Protein
abx168124-02 50 µg

Human Fibrillin 3 (FBN3) Protein

Sign In for Pricing
View Details
Human Fibrillin 3 (FBN3) Protein
abx168124-03 100 µg

Human Fibrillin 3 (FBN3) Protein

Sign In for Pricing
View Details